PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim00g024680.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 138aa    MW: 14819 Da    PI: 10.1302
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim00g024680.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.52.9e-3882136357
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57 
                         e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+
  Sopim00g024680.0.1  82 EAALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRR 136
                         6789**************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3765136IPR003851Zinc finger, Dof-type
PfamPF027012.5E-3283137IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.79885138IPR003851Zinc finger, Dof-type
PROSITE patternPS01361087123IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MVFSSIQAYL DSSNWQQAPP SNYNHDGTGA SANGGHVLRP QLQPQQQPHP NGSGGGGGGG  60
GGSIRAGSMV DRARQANVAL PEAALKCPRC ESTNTKFCYF NNYSLTQPRH FCKTCRRYWT  120
RGGALRNVPV GGGCRRXX
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15262SGGGGGGGGGS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935810.0AB493581.1 Arabidopsis thaliana At2g37590 mRNA for hypothetical protein, partial cds, clone: RAAt2g37590.
GenBankBT0300140.0BT030014.1 Arabidopsis thaliana At2g37590 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004253327.18e-98PREDICTED: dof zinc finger protein DOF2.4-like
SwissprotO809287e-76DOF24_ARATH; Dof zinc finger protein DOF2.4
TrEMBLC0SV786e-74C0SV78_ARATH; Putative uncharacterized protein At2g37590 (Fragment)
STRINGSolyc00g024680.1.14e-97(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.16e-77DNA binding with one finger 2.4